PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0041s0200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 704aa    MW: 79390.6 Da    PI: 5.2379
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0041s0200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS367.22.2e-1123316994374
                    GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                             lL++cA+av+ gd++ a++lL+++++++s  gd +qRla+yf++AL +r+a++++ ++  + + +ts    +e+l+a+++++ ++P+
  SapurV1A.0041s0200.1.p 331 LLTQCAQAVAIGDQRTASELLQQIRQHSSAFGDGNQRLAHYFANALDTRVAGTMTPTFTPIVSHRTS---AAESLKAYQVYVGACPF 414
                             89**************************************************777777666666665...9**************** PP

                    GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp 175
                              ++s++ aN++Il+ + ++ r+HiiDf+i +G+QWp+L++ L++R++gpp+lRiTg++ p++g   +e++eetg+rL+k++e+++vp
  SapurV1A.0041s0200.1.p 415 KRMSNFFANRTILKLARKAARLHIIDFGILYGFQWPCLIRRLSERRGGPPRLRITGIELPQPGfrPTERVEETGHRLEKYCERFKVP 501
                             **************************************************************9************************ PP

                    GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleale 262
                             fe+++ +a+++e++++e+L++++gE+++Vn+ ++l++l+d++v+ +s+rd+vLkl+++++P+++++   +   n++ F++rf eal+
  SapurV1A.0041s0200.1.p 502 FEYDA-IAQKWETIRYEDLKIDEGEMIVVNSLYRLKNLPDDTVAENSARDAVLKLINKIRPDIFIHGVVNGAFNAPYFVTRFREALY 587
                             *****.7******************************************************************************** PP

                    GRAS 263 yysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgy 349
                             +ys+lfd++ea++ re+e+r+  E+e  grei nv+aceg+ r+er et+++W++r  +aGF++++l+++  k+++++++  +++ +
  SapurV1A.0041s0200.1.p 588 HYSSLFDMFEATVLREDENRMLFEKEQYGREIINVIACEGSTRVERPETYKQWQSRNLRAGFRQLTLDQELFKDVSSVVKSEYQRDF 674
                             ***********************************************************************************999* PP

                    GRAS 350 rveeesgslvlgWkdrpLvsvSaWr 374
                              v+ + +++++gWk+r   ++S+W+
  SapurV1A.0041s0200.1.p 675 VVDADGQWMLQGWKGRITHALSVWK 699
                             ************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.444302679IPR005202Transcription factor GRAS
PfamPF035147.7E-110331699IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 704 aa     Download sequence    Send to blast
MDTLFQEFPN SMNRFIFDHA SVSLSPNRDL VIRYKLNDAS SNPNPSLDYF NTESPGESTS  60
SSSSSSNSSS EVDAPSNNVT LKFISDVLLE EDLEGKTCML QDCLALQAAE KSFYDVLGQE  120
YPHSMNHQSR SCFNQNVEST DDCVTLIDST GSTSGYHTSD WIFDQADLEL SQVLLPSPVF  180
SLENTLLGPD FQSPAQPPEM ASEGRGEAGS CLSSSDYLMP SPERSSSNPP DKEERGYSPD  240
SSSGRKNHQR EDSGGVEEER GKKHSALSPA ESEQSELFDE VLLYSCAQNV SSSCTDKSQN  300
GAWRNEPRKG SNCRAARAMR KEKKEVDLSP LLTQCAQAVA IGDQRTASEL LQQIRQHSSA  360
FGDGNQRLAH YFANALDTRV AGTMTPTFTP IVSHRTSAAE SLKAYQVYVG ACPFKRMSNF  420
FANRTILKLA RKAARLHIID FGILYGFQWP CLIRRLSERR GGPPRLRITG IELPQPGFRP  480
TERVEETGHR LEKYCERFKV PFEYDAIAQK WETIRYEDLK IDEGEMIVVN SLYRLKNLPD  540
DTVAENSARD AVLKLINKIR PDIFIHGVVN GAFNAPYFVT RFREALYHYS SLFDMFEATV  600
LREDENRMLF EKEQYGREII NVIACEGSTR VERPETYKQW QSRNLRAGFR QLTLDQELFK  660
DVSSVVKSEY QRDFVVDADG QWMLQGWKGR ITHALSVWKP VQE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-403326998375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299863.10.0hypothetical protein POPTR_0001s24890g
TrEMBLB9GJL60.0B9GJL6_POPTR; Uncharacterized protein
STRINGPOPTR_0001s24890.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.10.0GRAS family protein